PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462967600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 814aa    MW: 90703.3 Da    PI: 6.3888
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462967600genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-134785948
                     HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     d+ l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
        462967600 47 DDMLRKAVETYNGKNWKKIAECFP-GRTDVQCLHRWQKVL 85
                     67899*******************.************986 PP

2Myb_DNA-binding61.32e-1991137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
        462967600  91 KGPWSKEEDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 137
                      79******************************.*************97 PP

3Myb_DNA-binding48.81.7e-15143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+ +l++a++++G++ W+   + ++ gRt++ +k++w+
        462967600 143 KEAWTQEEEIKLIHAHQMYGNK-WAELTKFLP-GRTDNAIKNHWH 185
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.3E-83987IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-214797IPR009057Homeodomain-like
PfamPF002494.2E-114785IPR001005SANT/Myb domain
SuperFamilySSF466897.9E-124795IPR009057Homeodomain-like
PROSITE profilePS500907.9334785IPR017877Myb-like domain
CDDcd001679.07E-114785No hitNo description
PROSITE profilePS5129432.0486141IPR017930Myb domain
SuperFamilySSF466892.62E-3188184IPR009057Homeodomain-like
SMARTSM007175.3E-1890139IPR001005SANT/Myb domain
PfamPF002491.1E-1791137IPR001005SANT/Myb domain
CDDcd001671.37E-1593137No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2698140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-21141192IPR009057Homeodomain-like
PROSITE profilePS5129420.125142192IPR017930Myb domain
SMARTSM007172.8E-14142190IPR001005SANT/Myb domain
PfamPF002498.9E-14143185IPR001005SANT/Myb domain
CDDcd001675.10E-11145185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MAKLGAVGCA VVIAVVLRYH GRRAMDRLCW CVPGKGNFDR HSFGRMDDML RKAVETYNGK  60
NWKKIAECFP GRTDVQCLHR WQKVLNPELV KGPWSKEEDE IIIQMVNKLG PKKWSTIAQA  120
LPGRIGKQCR ERWHNHLNPG INKEAWTQEE EIKLIHAHQM YGNKWAELTK FLPGRTDNAI  180
KNHWHSSVKK KVDSYRASGL LGQFQGIAHV EYPAGSLNIA SSSAMSQQNS EDSGFNVVGE  240
VEGSTELSQS SLAKASCSQE EQIGSTLGSH FHAHESLCPE ECYTNADNDA SAVPEMQQQL  300
SISDNDQDTH LQHLSRTIDL PLDEQIARYE TSHFPDFHQV MEDNTCNNAS VDPDQHSYVS  360
SKDERDRAMD NLPESEKKKL IDVQQSSVEP TPTSGKETVS SHENTVASEK NDAEALCYEP  420
PYFPSYEVPF VRCDLISSSD LPEFSPLGIR ELMRSSLNFP TPVRLWSSPP RDGSPDAVLK  480
SAAKSFSSTP SIMKKRPREL LSPTADIRTE KNLMTEQNFG SLGMSSKRIR RSCIDTTDES  540
FHLFSPGDRT ASQQKKLKLF EENKENLKTT TNQDENEDNG KENLHSAGIL TQSNVDNLNT  600
PKHRPHHQSQ GLNTSTNALS NSIDIISSRS KPAELLVDKS PPCINAEFEY VNILADTPSI  660
KRGLESPSAW KSPLFSAFQS AYFMSPTARA FDALGLVKQI NEQSADALEE AHEVLASGSA  720
KNQHSKENSE KENIENTNYK NELTISKLPS KVMAEARVLD FNECSTPVRK KEDKKAESTI  780
GGPASSPLVP TYLRMNDLTL DAKCGPQAQR SSSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-624719214159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-624719214159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439473.10.0hypothetical protein SORBIDRAFT_09g007380
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
TrEMBLG9DR830.0G9DR83_WHEAT; R1R2R3-MYB protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.27e-91myb domain protein 3r-4